Protein Info for Rru_A1769 in Rhodospirillum rubrum S1H

Annotation: Acid phosphatase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 TIGR00087: 5'/3'-nucleotidase SurE" amino acids 12 to 249 (238 residues), 220 bits, see alignment E=1.7e-69 PF01975: SurE" amino acids 13 to 198 (186 residues), 205.6 bits, see alignment E=3.1e-65

Best Hits

Swiss-Prot: 100% identical to SURE_RHORT: 5'-nucleotidase SurE (surE) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03787, 5'-nucleotidase [EC: 3.1.3.5] (inferred from 100% identity to rru:Rru_A1769)

Predicted SEED Role

"5-nucleotidase SurE (EC 3.1.3.5)" in subsystem Folate Biosynthesis (EC 3.1.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTH6 at UniProt or InterPro

Protein Sequence (261 amino acids)

>Rru_A1769 Acid phosphatase (NCBI) (Rhodospirillum rubrum S1H)
MFSPLTDLSRARILLSNDDGFEAEGLAVLERVARTLSDDVWIVAPETEQSGAGHALTIHD
PLRFRARGEKRFSVRGTPTDCVLVAVNHLMDRPPDLVVSGINRGGNLGEDVHYSGTVAAA
MEGTLLGLRAIALSQVFETNGTGIADPFQVAATHASDVIRRVCGRPWNRQVLINVNFPDC
PLDAVTGIELKRQGRRKMGDDIEERRDPRDRPYLWIGAQRKEDRKTAGTDMEAISRGAIT
VTPLCVDMTDLPTIEALTGAF