Protein Info for Rru_A1763 in Rhodospirillum rubrum S1H

Annotation: SecF protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details amino acids 268 to 291 (24 residues), see Phobius details PF07549: Sec_GG" amino acids 37 to 60 (24 residues), 24.7 bits, see alignment (E = 1.3e-09) TIGR00966: protein-export membrane protein SecF" amino acids 42 to 287 (246 residues), 226.8 bits, see alignment E=3.6e-71 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 114 to 284 (171 residues), 163.1 bits, see alignment E=8.4e-52 PF02355: SecD_SecF_C" amino acids 118 to 294 (177 residues), 196.6 bits, see alignment E=2.8e-62

Best Hits

KEGG orthology group: K03074, preprotein translocase subunit SecF (inferred from 100% identity to rru:Rru_A1763)

Predicted SEED Role

"Protein-export membrane protein SecF (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTI2 at UniProt or InterPro

Protein Sequence (351 amino acids)

>Rru_A1763 SecF protein (NCBI) (Rhodospirillum rubrum S1H)
MPRPFARLTADFHYDFLVSRARVMAASAALLLVCLLALGLRGLDLGIDFTGGLVVEARTA
TAMDPVDLRQSLRASVVGEVDVTTYGEDGRSVTVRVGRQTGGDQAMLQALEGVKTALGEG
ATYRRTNLVGPTVGGEATIAGLLTVALALVLIAAYVWLRFDWHYALGVVLALSHDVVAVL
GLYALFQIPFDLTSIAALLTVACYSINDTVVIFDRVREELALTPDAPLATVVNKSINRTL
ARTIVLSGSTLVTMACLALLGGPQLRGFALALIWGTVVGTLSSIYVAVPALMAFRGRSKT
ADDGREGEDDGEDTPPPRAAPGKAKNAPAVAAGKPAQAKPAAAPPSRKERR