Protein Info for Rru_A1757 in Rhodospirillum rubrum S1H

Annotation: Gid protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01134: GIDA" amino acids 7 to 372 (366 residues), 334 bits, see alignment E=2.7e-103 TIGR00137: tRNA:m(5)U-54 methyltransferase" amino acids 7 to 449 (443 residues), 552.6 bits, see alignment E=3e-170 PF12831: FAD_oxidored" amino acids 8 to 37 (30 residues), 29 bits, see alignment (E = 1.4e-10) PF13450: NAD_binding_8" amino acids 9 to 37 (29 residues), 25.4 bits, see alignment (E = 2.9e-09) PF00890: FAD_binding_2" amino acids 9 to 57 (49 residues), 28.2 bits, see alignment 2.4e-10

Best Hits

Swiss-Prot: 100% identical to TRMFO_RHORT: Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase TrmFO (trmFO) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K04094, glucose inhibited division protein Gid (inferred from 100% identity to rru:Rru_A1757)

Predicted SEED Role

"tRNA:m(5)U-54 MTase gid" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTI8 at UniProt or InterPro

Protein Sequence (482 amino acids)

>Rru_A1757 Gid protein (NCBI) (Rhodospirillum rubrum S1H)
MTQHPPLTIVGGGLAGCEAAWQAARAGLRVILIEMRPLRTTEAHLGDGLAELVCSNSLRS
DDPLYNAVGLLHEEMRRAGSLILAMAEAHRVPAGGALAVDRQGFSDAITRALAEHPLIEI
RRGEVDRLPAVEDGPAIIASGPLTSAALAAAIAEATGETSLAFFDAIAPIVHKDSIDFDR
AWFQSRYDKGDGRDYINCPLTRDQYDAFVDALLAGEKTMFKEWEGTPYFDGCLPIEVMAE
RGRETLAFGPMKPVGLTDPRNPGLRPHAVVQLRQDNALGTLYNMVGFQTKLKHGEQARIF
RMIPGLENAEFARLGGIHRNTFLNSPRLLDPTLRLKARPHLRFAGQITGCEGYVESAAIG
LLAGRFASAEILDAASFAPPPPTTALGGLLGHITGGANAETFQPMNVNFGLLPPLEARPV
RPGAKPRVPKGRERKLESARRALVDLGDWLRQPSPWSAEDSPRAALPIPEPTPLGPASGS
SE