Protein Info for Rru_A1751 in Rhodospirillum rubrum S1H

Annotation: inner-membrane translocator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 42 to 59 (18 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 288 (281 residues), 166.8 bits, see alignment E=2.8e-53

Best Hits

Swiss-Prot: 57% identical to BRAD_PSEAE: High-affinity branched-chain amino acid transport system permease protein BraD (braD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to rru:Rru_A1751)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTJ4 at UniProt or InterPro

Protein Sequence (304 amino acids)

>Rru_A1751 inner-membrane translocator (NCBI) (Rhodospirillum rubrum S1H)
MAYFLQQLINGLTLGAIYGLIAIGYTMVYGIIGMINFAHGEIYMIGAFLTVICFVLLGGP
EFASVPLALLLILVVSMVFTAAYGWTVERLAYRPLRGSFRLAPLISAIGMSIALQNYVQI
TQGARVKPIQPVIRGGFEVFNQGGFAVQISYLQIFIWILTIGLMMGFTYVITQTSMGRQQ
RACEQDRKMASLIGVNVDRTISLTFVIGALLAAVAGLITTLYYGVIDFYIGFLAGMKAFT
AAVLGGIGSLPGAMLGGLLIGLIEAFWSAYFTIEYKDVATFGILVLVLIFKPTGFLGKPE
VEKV