Protein Info for Rru_A1725 in Rhodospirillum rubrum S1H

Annotation: Carbonate dehydratase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00194: Carb_anhydrase" amino acids 45 to 256 (212 residues), 130.2 bits, see alignment E=5.2e-42

Best Hits

Swiss-Prot: 43% identical to CAH_NOSS1: Carbonic anhydrase (ecaA) from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)

KEGG orthology group: K01674, carbonic anhydrase [EC: 4.2.1.1] (inferred from 100% identity to rru:Rru_A1725)

Predicted SEED Role

"Carbonic anhydrase (EC 4.2.1.1)" in subsystem Carboxysome or Cyanate hydrolysis (EC 4.2.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.1

Use Curated BLAST to search for 4.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTM0 at UniProt or InterPro

Protein Sequence (259 amino acids)

>Rru_A1725 Carbonate dehydratase (NCBI) (Rhodospirillum rubrum S1H)
MVMQRAFSHAAMAVAFGLVGFSGAPAVAAETAHPPHWAYEGKGGPVDWGALSEDYHACAA
GKEQSPVDIRDAIPAKLPAIAPAYQAQSAVVVNNGHTLQVNVSPGSSLDFRGQRYELLQY
HFHHPSEHLVNGKAAPLELHLVHKGPTALTVIGVMLVPGAANPAIEAIWKVAPAKEGGEA
TLGDPGPDLGKLLPESKSYTFYEGSLTTPPCSEVVNWINLKTPVTVSEDQIARFAALFPM
NARPPQALHRRIILESQDQ