Protein Info for Rru_A1720 in Rhodospirillum rubrum S1H

Annotation: Carboxymuconolactone decarboxylase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 transmembrane" amino acids 41 to 61 (21 residues), see Phobius details amino acids 73 to 96 (24 residues), see Phobius details PF02627: CMD" amino acids 15 to 94 (80 residues), 53.9 bits, see alignment E=7.3e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1720)

Predicted SEED Role

"carboxymuconolactone decarboxylase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTM5 at UniProt or InterPro

Protein Sequence (104 amino acids)

>Rru_A1720 Carboxymuconolactone decarboxylase (NCBI) (Rhodospirillum rubrum S1H)
MAVSKAFERFFAEAPGHAKAWMAAVQGLDQASGLDKKTEELAYLGVLAAARLPSGIAFHV
QSAKAAGATREEIIGAVLIGLPAVGAGVIEALPIALDAYDQSGQ