Protein Info for Rru_A1698 in Rhodospirillum rubrum S1H

Annotation: Cation efflux protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 58 to 75 (18 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 126 to 149 (24 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 24 to 318 (295 residues), 217.2 bits, see alignment E=1.4e-68 PF01545: Cation_efflux" amino acids 29 to 242 (214 residues), 120.3 bits, see alignment E=4.8e-39

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1698)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTP7 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Rru_A1698 Cation efflux protein (NCBI) (Rhodospirillum rubrum S1H)
MHTHDLSPWTHDHVYATGGEAAAERRTRLVVALTVAMMGLEIVVGTLTNSMALLADGFHM
ATHAAALGIAAFAYAHARRHAFDRRYSFGTGKVGALAAFTSAIILGVVALGMVWESASRF
FSVQTIAFEQALIVATLGLVVNLLSVLILGGPGQAPHHDHGHDHGHGHGHDHGHGAHEDH
NIRAAYLHVMADAVTSVLAIVALLFGKYMGWWWLDPLIGIVGAAVIGRWAWGLMMRSGAV
LLDHSADKGLEDEVRMAIEGDGTAINRVADLHLWQVGPGHWAAIVSVVSDIVQPIAHYRA
LLAEVHELSHVTIEVQACAGCEGDCGCACGAATASAV