Protein Info for Rru_A1681 in Rhodospirillum rubrum S1H

Annotation: Potassium uptake protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13241: NAD_binding_7" amino acids 2 to 89 (88 residues), 25.4 bits, see alignment E=1e-08 PF02254: TrkA_N" amino acids 3 to 126 (124 residues), 96.2 bits, see alignment E=9.8e-31 amino acids 236 to 354 (119 residues), 81.4 bits, see alignment E=3.9e-26 PF02080: TrkA_C" amino acids 159 to 226 (68 residues), 37 bits, see alignment E=1.6e-12 amino acids 390 to 451 (62 residues), 60.8 bits, see alignment E=5.9e-20

Best Hits

Swiss-Prot: 55% identical to TRKA_AZOC5: Trk system potassium uptake protein TrkA (trkA) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K03499, trk system potassium uptake protein TrkA (inferred from 100% identity to rru:Rru_A1681)

Predicted SEED Role

"Trk system potassium uptake protein TrkA" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTR4 at UniProt or InterPro

Protein Sequence (458 amino acids)

>Rru_A1681 Potassium uptake protein (NCBI) (Rhodospirillum rubrum S1H)
MKVIVCGAGQVGFSIARYLAAENNDVTVVDQRPELIRSISDTLDVQALVGYASHPGVLEK
AGAEDADMLIAVTHADEVNMVACQVAHSLFNVPTKIARVRNQNYLQPHWANLFSRENMPI
DVIISPEIEVARAIIRRLQVPGAMDIIPLAGDRVRLIGVRCTENTPVVHTPLRQLTQLFP
ELNIVVVGIVRNDRAIVPSAEDQMLPGDEVYFVVSTDRTQRALSAFGHEETAARRVLIFG
GGNVGLFLAQALERDFPQVSAKIIENNKERAQHVAKTLDRTMVLLGDALNPEMLEEAGVA
QAETVVAVSNDDETNILASLLAKRYGCQRAITLINKSTYNSLVGTVGVDVVVNPRTITVS
KILQHVRRGRIHSVHSLHEGFGELIEADALDTSPLVGKPLKDVNLPAGVLLGAIVRGTQV
ISPRGTTVIQGGDRIILFASTAAIKKVEKMFSVRIEFF