Protein Info for Rru_A1679 in Rhodospirillum rubrum S1H

Annotation: Multi-sensor Signal Transduction Histidine Kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 760 transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 299 to 323 (25 residues), see Phobius details PF19312: NtrY_N" amino acids 47 to 311 (265 residues), 117.7 bits, see alignment E=1.7e-37 PF00672: HAMP" amino acids 323 to 374 (52 residues), 38.8 bits, see alignment 2.3e-13 PF00989: PAS" amino acids 395 to 497 (103 residues), 28 bits, see alignment E=4.6e-10 PF00512: HisKA" amino acids 511 to 577 (67 residues), 42.1 bits, see alignment E=1.8e-14 PF02518: HATPase_c" amino acids 620 to 736 (117 residues), 80.4 bits, see alignment E=3.4e-26

Best Hits

KEGG orthology group: K13598, two-component system, NtrC family, nitrogen regulation sensor histidine kinase NtrY [EC: 2.7.13.3] (inferred from 100% identity to rru:Rru_A1679)

Predicted SEED Role

"Nitrogen regulation protein NtrY (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTR6 at UniProt or InterPro

Protein Sequence (760 amino acids)

>Rru_A1679 Multi-sensor Signal Transduction Histidine Kinase (NCBI) (Rhodospirillum rubrum S1H)
MSPTSQRRGGRPALNRTILRLGLWARRVKLSRRLAVALAVASLISGGVTFFLLSSPEPSS
RAIWILLNVDLVILLALGGLITRSVVRMWSSRRSGGAGSRLQVRLAVLFSAVAITPAILL
AIFSTIAFQVSFQSWFDEKVSTAVRESQEVAEAYLQAHMNAIAGDAALTANDLNREWRRM
PNSQVLNQFLTTQSLVRNLSEVVVFTREGNVLGRAGYTFSLQFEQVPNYLIDQADLGEVV
VIPGQGNDRVRALVELGTPGTYLYVGRFVDAAVRDHIEKAHAAVSEYLAFQAQSSKLQIL
YFLTYIVVSLLLLLAAIWVGITIANRLAQPIMDLIEAAGKVSEGNLSVRVSELVASDEVA
LLGRAFNRMTIRLESQQKSLLAANLELDERRRFTETVLAGVSAGVIGVDAEGKINLPNPS
ACALFDRDLTLWQGQPIGALLAEFGEVLTAVRQRPDRPVEREMEIRIDRRPVTLLVRVAA
ECSAQGITGFVFTFDDITELQSAQRKAAWADVARRIAHEIKNPLTPIQLSAERLKRKYLK
QITDDPETFARCTETIIRHVGDIGQMVDEFSAFARMPAPEIRPCDLGELVLQSVVLQRTA
YGQIGFSTELPEGKVIVAADGRQITQALTNLLKNAVEAIQGRDRPAEGAPPLPAGRIAVS
LTLTNDQAVVRIVDNGRGLPDMETKRLTEPYVTTRAKGTGLGLAIVKKILEDHGGDLVLE
NASGGGAAISLTLPLTPVVRAADPGFASQPPLQADPIHGA