Protein Info for Rru_A1678 in Rhodospirillum rubrum S1H

Annotation: Nitrogen Metabolism Transcriptional Regulator, NtrC, Fis Family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 PF00072: Response_reg" amino acids 4 to 113 (110 residues), 87.2 bits, see alignment E=2.5e-28 TIGR01818: nitrogen regulation protein NR(I)" amino acids 4 to 471 (468 residues), 706.5 bits, see alignment E=7.8e-217 PF00158: Sigma54_activat" amino acids 139 to 305 (167 residues), 240.2 bits, see alignment E=3.1e-75 PF14532: Sigma54_activ_2" amino acids 140 to 310 (171 residues), 82.6 bits, see alignment E=9.9e-27 PF07728: AAA_5" amino acids 163 to 281 (119 residues), 32.7 bits, see alignment E=2.1e-11 PF02954: HTH_8" amino acids 432 to 469 (38 residues), 49.4 bits, see alignment 8.7e-17

Best Hits

Swiss-Prot: 77% identical to NTRC_AZOBR: DNA-binding transcriptional regulator NtrC (ntrC) from Azospirillum brasilense

KEGG orthology group: K07712, two-component system, NtrC family, nitrogen regulation response regulator GlnG (inferred from 100% identity to rru:Rru_A1678)

Predicted SEED Role

"Nitrogen regulation protein NtrC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTR7 at UniProt or InterPro

Protein Sequence (481 amino acids)

>Rru_A1678 Nitrogen Metabolism Transcriptional Regulator, NtrC, Fis Family (NCBI) (Rhodospirillum rubrum S1H)
MSTILVADDDRGIRTVLSQALTRAGHEVRSTGTASTLWSWVTDGQGDLVITDVIMPDENG
LDLIPRIKKIRPDLRIVVMSAQNTLLTAVKATERGAFEYLPKPFDLTEVVNVVRRALSLP
RGNPTEGDHASEEDERLPLIGRSPAMQEIYRTLARLMNTDLTVMINGESGTGKELVARAL
HDYGKRRNGSFVAVNMGAIPRELIESELFGHEKGAFTGAHARSAGRFEQADGGTLFLDEI
GDMPLEAQTRLLRVLQESEYTTVGGRQTLRANVRIIAATHRDLRQLIHQGLFREDLFYRL
NVVPLRLPPLRERVEDIPELTRHFLHAVAEHDGLPPKVLEAPAMERLKKHRWSGNVRELE
NLVRRLAALYSQEVIGVEVIEAELSSSAPPILDEGDESAEGLSTKVERHLRHYFEAHGEA
LPPAGLHERISREVERPLISLCLEATRGNQIKAAQLLGLNRNTLRKKIRDLDIQVVRGVK
G