Protein Info for Rru_A1668 in Rhodospirillum rubrum S1H

Annotation: Integration host factor, alpha subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 PF18291: HU-HIG" amino acids 3 to 96 (94 residues), 31.5 bits, see alignment E=1.7e-11 TIGR00987: integration host factor, alpha subunit" amino acids 5 to 96 (92 residues), 140.9 bits, see alignment E=6.8e-46 PF00216: Bac_DNA_binding" amino acids 7 to 95 (89 residues), 93.7 bits, see alignment E=6.9e-31

Best Hits

Swiss-Prot: 100% identical to IHFA_RHORT: Integration host factor subunit alpha (ihfA) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K04764, integration host factor subunit alpha (inferred from 100% identity to rru:Rru_A1668)

Predicted SEED Role

"Integration host factor alpha subunit" in subsystem DNA structural proteins, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTS7 at UniProt or InterPro

Protein Sequence (105 amino acids)

>Rru_A1668 Integration host factor, alpha subunit (NCBI) (Rhodospirillum rubrum S1H)
MSGKTITRAQLSEAVYQEVGLSRNESADLLEMVLNEMSEALVEGDTVKISSFGSFSVREK
GERVGRNPKTGEEVPILPRRVLVFRPSQLLKARINDGAVGSQING