Protein Info for Rru_A1643 in Rhodospirillum rubrum S1H

Annotation: Binding-protein-dependent transport systems inner membrane component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 98 to 123 (26 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 77 to 245 (169 residues), 104.9 bits, see alignment E=2.2e-34

Best Hits

Swiss-Prot: 58% identical to Y355_HAEIN: Probable ABC transporter permease protein HI_0355 (HI_0355) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to rru:Rru_A1643)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTV2 at UniProt or InterPro

Protein Sequence (261 amino acids)

>Rru_A1643 Binding-protein-dependent transport systems inner membrane component (NCBI) (Rhodospirillum rubrum S1H)
MTARPCRRGLPLRLAGIALSLGALIGLWHLAFVLAGARPYLLPSPWQTAQALIGRWPTIL
PHAGTTALEIVLGLGLGTLLGALSALTIALSPLMRRMLLPLLVISQAIPVFAIAPLLVLW
LGYGLASKVAMATLVIYFPVTTAFLDGLRRTEPGWLDLARTMGASPLSTLLRIRLPAALP
ALASGLRVATAVAPIGAVVGEWVGSSAGLGYLMLHANARMQIDLMFAALFVLTVFSLGLY
ALVDRTLRAALPWQRETLDGD