Protein Info for Rru_A1632 in Rhodospirillum rubrum S1H

Annotation: NADH dehydrogenase (quinone) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 47 (18 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 119 to 136 (18 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details amino acids 330 to 353 (24 residues), see Phobius details amino acids 373 to 398 (26 residues), see Phobius details amino acids 418 to 440 (23 residues), see Phobius details amino acids 455 to 474 (20 residues), see Phobius details amino acids 545 to 563 (19 residues), see Phobius details PF00361: Proton_antipo_M" amino acids 112 to 378 (267 residues), 147.9 bits, see alignment E=1.9e-47

Best Hits

KEGG orthology group: K05568, multicomponent Na+:H+ antiporter subunit D (inferred from 100% identity to rru:Rru_A1632)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain L (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTW3 at UniProt or InterPro

Protein Sequence (565 amino acids)

>Rru_A1632 NADH dehydrogenase (quinone) (NCBI) (Rhodospirillum rubrum S1H)
MAIEALPPALLMILGGLMLPLLPKRAQDPLMVFLPLATLWAVWQIADGPMMLVRFLDLVL
EPVRGDAVGRLFASVFSLMAFAGGLFALKQPRVLERAAALVYAGGAVGCALAGDLISLFV
FWEIMAVASTLVIWSSDQPAAAKAGMRYALMHLFGGAVLMAGIAGHAIGGGSLDVTAMTL
DSPANWLILIGVLVNAGAPPFSAWIADAYPEGSFSGSVFLSAFTTKTAVMVLIKGFPGTE
LLIWIGLAMVFYGILYALLENDMRRILSYSIVNQVGFMVCAVGIGTDMALNGAAAHAFAH
ILYKALLLMSAGSVLMMTGGKRKCTELGGLYRSMPITTVCGIIGALAISAFPFTSGFVSK
SMIAQGAADQHLVWVWALLQAASAGVFLHAGIKFPWFVFFQKDSGLRPADPPASMRAAMI
LLAAACIGLGVFPGALYALLPAPTDYQPYTADHLVSQFQLLLFAGLAFFVLLPLMKRTRT
LSLDIDWLYRRLLPDLLRALAPPANRLGAALTAQALAGVKAVTGVVARSHGPDGSFGRPW
PTGRSVAVILGLLGAYLIFAALGHP