Protein Info for Rru_A1621 in Rhodospirillum rubrum S1H

Annotation: Dihydrouridine synthase TIM-barrel protein yjbN (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 TIGR00742: tRNA dihydrouridine synthase A" amino acids 19 to 340 (322 residues), 415.8 bits, see alignment E=6.4e-129 PF01207: Dus" amino acids 23 to 324 (302 residues), 258 bits, see alignment E=5.6e-81

Best Hits

Swiss-Prot: 56% identical to DUSAL_SYNY3: tRNA-dihydrouridine(20/20a) synthase (dus2) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K05539, tRNA-dihydrouridine synthase A [EC: 1.-.-.-] (inferred from 100% identity to rru:Rru_A1621)

Predicted SEED Role

"tRNA dihydrouridine synthase A"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RTX4 at UniProt or InterPro

Protein Sequence (349 amino acids)

>Rru_A1621 Dihydrouridine synthase TIM-barrel protein yjbN (NCBI) (Rhodospirillum rubrum S1H)
MMVSAPAPRSQPDRSQPDRRLSVAPMMDWTDRHDRWFLRQITKRTLLYTEMITAQALLHA
DPGRFLDHHPDEHPLALQLGGSDPRALAEATRLAAPFGFAEINLNVGCPSDRVSSGRFGA
CLMADPALVAECLSAMAEASNAPVTIKHRIGIDDLDSYDQLVGFVDQVARSGIATIIVHA
RKAWLKGLSPKENREIPPLRHDVVHRLKADFPGLEVILNGGITTLTQALDHLGSGDPAAP
AVDGVMIGRAAYETPYMLAQADGLIFGEATPAPSRHEVALALLPYLDAMTARGEPVKRLT
RHILGLFHGQPGARAYRRHLGEAGVRPDATAQVLIDALAHIPALDEAES