Protein Info for Rru_A1572 in Rhodospirillum rubrum S1H

Annotation: Glyoxalase/bleomycin resistance protein/dioxygenase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 TIGR03081: methylmalonyl-CoA epimerase" amino acids 4 to 133 (130 residues), 169.9 bits, see alignment E=1.9e-54 PF00903: Glyoxalase" amino acids 4 to 130 (127 residues), 57.6 bits, see alignment E=2.6e-19 PF13468: Glyoxalase_3" amino acids 5 to 101 (97 residues), 32.3 bits, see alignment E=1.5e-11 PF13669: Glyoxalase_4" amino acids 6 to 118 (113 residues), 85.9 bits, see alignment E=3.5e-28

Best Hits

KEGG orthology group: K05606, methylmalonyl-CoA epimerase [EC: 5.1.99.1] (inferred from 100% identity to rru:Rru_A1572)

MetaCyc: 81% identical to ethylmalonyl-CoA/methylmalonyl-CoA epimerase (Cereibacter sphaeroides)
Methylmalonyl-CoA epimerase. [EC: 5.1.99.1]; 5.1.99.1 [EC: 5.1.99.1]

Predicted SEED Role

"Methylmalonyl-CoA epimerase (EC 5.1.99.1); Ethylmalonyl-CoA epimerase" (EC 5.1.99.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RU23 at UniProt or InterPro

Protein Sequence (134 amino acids)

>Rru_A1572 Glyoxalase/bleomycin resistance protein/dioxygenase (NCBI) (Rhodospirillum rubrum S1H)
MIGRLNHVAIAVPDLEAACAVYRDALGATVSAPLPQPDHGVTVVFVELPNTKIELLHPLG
EASPIAAFLSKSPAGGIHHICYEVEDILAARDHMKAEGKRVLGDGEPRLGAHGKPVLFLH
PKDFNGTLVELEQA