Protein Info for Rru_A1564 in Rhodospirillum rubrum S1H

Annotation: NADH-ubiquinone/plastoquinone oxidoreductase, chain 6 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 49 (19 residues), see Phobius details amino acids 55 to 78 (24 residues), see Phobius details amino acids 90 to 115 (26 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details PF00499: Oxidored_q3" amino acids 18 to 168 (151 residues), 137 bits, see alignment E=2e-44

Best Hits

Swiss-Prot: 55% identical to NQO10_PARDE: NADH-quinone oxidoreductase chain 10 (nqo10) from Paracoccus denitrificans

KEGG orthology group: K00339, NADH dehydrogenase I subunit J [EC: 1.6.5.3] (inferred from 100% identity to rru:Rru_A1564)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain J (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RU31 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Rru_A1564 NADH-ubiquinone/plastoquinone oxidoreductase, chain 6 (NCBI) (Rhodospirillum rubrum S1H)
MIIQALIFYMLAAIMVASAFMVVISRNPVHSVLWLILTFVNSAGLFLLMGAEFVAMVVVV
VYVGAVAVLFLFVVMMLDINYLRLREGFLSYMPLGAAMGVVLLAEIAVLAGGWAMAPDAM
GLRRVPMVDPAALTNTQAIGQVLYTDYIYLFQAAGLVLLVAMIGSIMLTHRANPLVKRQN
VADQIARRKERTLKLNKVPTGRGIS