Protein Info for Rru_A1549 in Rhodospirillum rubrum S1H

Annotation: Trigger factor (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 PF05697: Trigger_N" amino acids 17 to 161 (145 residues), 131.5 bits, see alignment E=4.5e-42 TIGR00115: trigger factor" amino acids 27 to 436 (410 residues), 424.4 bits, see alignment E=2.2e-131 PF00254: FKBP_C" amino acids 176 to 256 (81 residues), 58.7 bits, see alignment E=9e-20 PF05698: Trigger_C" amino acids 281 to 436 (156 residues), 122.4 bits, see alignment E=2.9e-39

Best Hits

Swiss-Prot: 100% identical to TIG_RHORT: Trigger factor (tig) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03545, trigger factor (inferred from 100% identity to rru:Rru_A1549)

Predicted SEED Role

"Cell division trigger factor (EC 5.2.1.8)" in subsystem Bacterial Cell Division (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RU46 at UniProt or InterPro

Protein Sequence (463 amino acids)

>Rru_A1549 Trigger factor (NCBI) (Rhodospirillum rubrum S1H)
MAGFRLSTRKVVREQPMQVTETVNESLKREYKIVIPAADIAERSARRLEELKGQMRLPGF
RPGKVPMSMLRQRFGKSVLGEVLEKAVQESIREVMTSHELKPATQPDIDLISEVEEGKDV
EFTLALEVLPEIGETDFSALALEREVAEVAAEKIEEALETLRQQSKTHEPVTDGRAAAGG
DLVVIDFIGKLDGEAFEGGSAEAYDLELGSNSFIPGFEDQLIGATAGEARTVTVSFPEDY
PAAHLAGKETVFDVTVKEVKQAVVPELDDDLAKAFGKESAEALREAVKADLQGELDEVSK
TKLKRKLLDALADGHDFPVPQTLVDAEFEGIWAQIEKAKTDGQLDEEDAAKSDEDLRADY
RKIAERRVRLGLLLADVGQRAQVTVAQEDLNKALMRELRRFPGQEAAVINYYRNNQQAMD
NLRAPVFEDKVCAHILALATVTDKPVSVEDLMKDPDEDATPTA