Protein Info for Rru_A1544 in Rhodospirillum rubrum S1H

Annotation: Putative diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 764 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 37 to 140 (104 residues), 38.3 bits, see alignment E=1.3e-13 amino acids 190 to 309 (120 residues), 86.4 bits, see alignment E=1.7e-28 PF00989: PAS" amino acids 38 to 140 (103 residues), 31.8 bits, see alignment E=4.9e-11 amino acids 190 to 297 (108 residues), 57.8 bits, see alignment E=4.1e-19 PF13188: PAS_8" amino acids 38 to 86 (49 residues), 29.1 bits, see alignment 2.7e-10 amino acids 189 to 230 (42 residues), 28.1 bits, see alignment 6e-10 PF08448: PAS_4" amino acids 44 to 140 (97 residues), 33.3 bits, see alignment E=2.1e-11 amino acids 194 to 303 (110 residues), 53.1 bits, see alignment E=1.5e-17 PF13426: PAS_9" amino acids 48 to 141 (94 residues), 30.7 bits, see alignment E=1.3e-10 amino acids 200 to 301 (102 residues), 70.4 bits, see alignment E=5.4e-23 PF08447: PAS_3" amino acids 211 to 295 (85 residues), 48.8 bits, see alignment E=2.8e-16 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 311 to 471 (161 residues), 139.2 bits, see alignment E=1.1e-44 PF00990: GGDEF" amino acids 313 to 469 (157 residues), 161.7 bits, see alignment E=5.1e-51 PF00563: EAL" amino acids 491 to 724 (234 residues), 216.9 bits, see alignment E=1.1e-67

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1544)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RU51 at UniProt or InterPro

Protein Sequence (764 amino acids)

>Rru_A1544 Putative diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s) (NCBI) (Rhodospirillum rubrum S1H)
MAADVVFPGLCVFLSAGLLLALVHGRRVGRRADRQCRHLAAITDTMSEGFYVVDGDDRIV
MANAAAGRILGYTQDDLIGACAHALFHARSADDPDPVPLEECRLNRAVRERRAAFLDVGH
FRHRSGKIIAVEVSCNPVADTLAEEGRRGGLLGWLLDGDDAEGAPGALLSMVTFVDITAR
RESEAAVIKLSHAVEQSSASIVITDADGRIEYANPAFTKISGYTAQEAIGRRPSILKSGL
VPAETYRALWQTITNGGEWRGEFHNRRKDGTLYWEMASISPIRDARGKITNFVAVKDDVT
ERKAIESELYHRANYDALTGLPNRQLLLDRVSTALDLARRHDRRVAVMFMDIDRFKQIND
SMGHAAGDVLLKQAASRLAAVLRPQDTLGRLGGDEFLVVAPGLRWESEATALASRLLEVA
RRPFTIDGREVYVSVSIGVSLGPVDGTTAQALMRNADAAMYLAKGGGRDAAHFFTPDIEA
AARRRMLIENGLRTAVSDGSLYLALQPIIACADHTMIKAEALLRWTHPQLGGVPPSEFIP
IAEESGLIRAIGAWVIEEAARLLVSLDPPRDGAFRLGINIASSQFTGGLHHHVAGMLARY
DLDPRMLEIEITERMLLDPSPAILEQVDALRAMGVSIAIDDFGTGYSALSYLSVFHVDTL
KIDRAFVSVMTDEARSQALIGAIVALGHELGCAVVAEGVETADQARLLGELAVDALQGYF
LGRPTTAEAISDRLNPGTGRPYDKAALGTEFAEGGDLGLSVGAL