Protein Info for Rru_A1534 in Rhodospirillum rubrum S1H

Annotation: Cl- channel, voltage gated (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 119 to 135 (17 residues), see Phobius details amino acids 142 to 156 (15 residues), see Phobius details amino acids 165 to 188 (24 residues), see Phobius details amino acids 195 to 219 (25 residues), see Phobius details amino acids 239 to 263 (25 residues), see Phobius details amino acids 278 to 300 (23 residues), see Phobius details amino acids 315 to 337 (23 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details amino acids 369 to 394 (26 residues), see Phobius details amino acids 400 to 420 (21 residues), see Phobius details PF00654: Voltage_CLC" amino acids 79 to 418 (340 residues), 283.9 bits, see alignment E=9.6e-89

Best Hits

KEGG orthology group: K03281, chloride channel protein, CIC family (inferred from 100% identity to rru:Rru_A1534)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RU61 at UniProt or InterPro

Protein Sequence (527 amino acids)

>Rru_A1534 Cl- channel, voltage gated (NCBI) (Rhodospirillum rubrum S1H)
MQLNSPGVLFRLRRLLRTQSLVLGALAVGIGLLVGAGTVAFREAIDLVQTLFYGGDDLYL
ARLARSLPGWLVVLGPTAGGLLVGLYYAKVMPGGKPQGVAQVIGAVARTGGRMRAGDGVL
AACGSALSLGCGASVGREGPAVHLGAALAAGLAGRLRLGPGLARTVLGCGVAAAVAASFN
APIAGALFAGEVVIGHYALSAFAPIVVSSVVATVLSRGWFGDFPAFILPHLTLASAWEFP
AFVVLGGLCGLVAVAFMRGVFLAGGLASALRLPVVLRPMVAGALVGLLALVLPEVLGVGY
EATDQVLKGAYHLDLLLPLILAKLAASVICLGFGFGGGVFSPSLTLGALVGGAFGLAIAL
VAPVSASGAYALIGMGALSAAVLGAPISTTLIVFELTGDYALSVGTMVAAVVAGALSRQI
CGHLSFFRWQLAKQGIDLEVPKAEGVLRVLRIGDLTWSAPPQRPAGGAALVSVTAEETLA
VALARLRQSGAEGLVVVDDQGRPIGGLRETDLAWACVRALDEAEGDR