Protein Info for Rru_A1522 in Rhodospirillum rubrum S1H

Annotation: Beta-lactamase-like (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF00753: Lactamase_B" amino acids 11 to 194 (184 residues), 120.6 bits, see alignment E=4.3e-39

Best Hits

Swiss-Prot: 56% identical to GLO22_ECOLI: Hydroxyacylglutathione hydrolase GloC (gloC) from Escherichia coli (strain K12)

KEGG orthology group: K01069, hydroxyacylglutathione hydrolase [EC: 3.1.2.6] (inferred from 100% identity to rru:Rru_A1522)

MetaCyc: 56% identical to hydroxyacylglutathione hydrolase GloC (Escherichia coli K-12 substr. MG1655)
Hydroxyacylglutathione hydrolase. [EC: 3.1.2.6]

Predicted SEED Role

"Hypothetical metal-binding enzyme, YcbL homolog"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.6

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RU73 at UniProt or InterPro

Protein Sequence (214 amino acids)

>Rru_A1522 Beta-lactamase-like (NCBI) (Rhodospirillum rubrum S1H)
MALKATILPVTPFQQNCTLLWCDETMAGALVDAGGDVDRLLQAVEKTGVRLEKLLVTHGH
LDHAGGVAEIQERLGLPVEGPHADDAFLIEGMADQALRFGFPEGRSFVPDRWLVQGDKVS
LGALTLEVLHCPGHTPGHVVFFEPTARVAQVGDVLFRGSIGRTDFPRGDHATLLASIHDR
LLPLGDDVTIIPGHGPLSTLGEERRTNPYLEHGA