Protein Info for Rru_A1522 in Rhodospirillum rubrum S1H
Annotation: Beta-lactamase-like (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 56% identical to GLO22_ECOLI: Hydroxyacylglutathione hydrolase GloC (gloC) from Escherichia coli (strain K12)
KEGG orthology group: K01069, hydroxyacylglutathione hydrolase [EC: 3.1.2.6] (inferred from 100% identity to rru:Rru_A1522)MetaCyc: 56% identical to hydroxyacylglutathione hydrolase GloC (Escherichia coli K-12 substr. MG1655)
Hydroxyacylglutathione hydrolase. [EC: 3.1.2.6]
Predicted SEED Role
"Hypothetical metal-binding enzyme, YcbL homolog"
MetaCyc Pathways
- methylglyoxal degradation VIII (3/3 steps found)
- methylglyoxal degradation I (2/3 steps found)
- superpathway of methylglyoxal degradation (4/8 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 3.1.2.6
Use Curated BLAST to search for 3.1.2.6
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2RU73 at UniProt or InterPro
Protein Sequence (214 amino acids)
>Rru_A1522 Beta-lactamase-like (NCBI) (Rhodospirillum rubrum S1H) MALKATILPVTPFQQNCTLLWCDETMAGALVDAGGDVDRLLQAVEKTGVRLEKLLVTHGH LDHAGGVAEIQERLGLPVEGPHADDAFLIEGMADQALRFGFPEGRSFVPDRWLVQGDKVS LGALTLEVLHCPGHTPGHVVFFEPTARVAQVGDVLFRGSIGRTDFPRGDHATLLASIHDR LLPLGDDVTIIPGHGPLSTLGEERRTNPYLEHGA