Protein Info for Rru_A1488 in Rhodospirillum rubrum S1H

Annotation: Metallophosphoesterase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF00149: Metallophos" amino acids 27 to 201 (175 residues), 47.7 bits, see alignment E=1.3e-16

Best Hits

KEGG orthology group: K07313, serine/threonine protein phosphatase 1 [EC: 3.1.3.16] (inferred from 100% identity to rru:Rru_A1488)

Predicted SEED Role

"serine/threonine protein phosphatase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.16

Use Curated BLAST to search for 3.1.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUA6 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Rru_A1488 Metallophosphoesterase (NCBI) (Rhodospirillum rubrum S1H)
MIRETWKRLTSASSPPPAAPAVPSGVRVYAIGDIHGQIDALDRLHDLIVRDAAAEAGSAR
RFLIIYLGDYVDRGEATPAVLDRLCGPSLPGFERHCLRGNHESAMLDFLEAPTANLGWLE
FGGLATLAGYGVRMPGVSGLAARAEGLAKGLDACLPAAHRAFLGGLASQISIGDYLFVHA
GVMPGRPLDRQSEDDLLWIREPFLSSPLWHGKRVVHGHTISEAPVVLPNRIGIDTGAFAG
GPLTCVVLEDETLRFIATDEYHYRAR