Protein Info for Rru_A1475 in Rhodospirillum rubrum S1H

Annotation: Citrate transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 98 to 126 (29 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 231 to 248 (18 residues), see Phobius details amino acids 254 to 272 (19 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details amino acids 324 to 341 (18 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details amino acids 383 to 404 (22 residues), see Phobius details amino acids 410 to 431 (22 residues), see Phobius details TIGR00784: citrate transporter" amino acids 1 to 431 (431 residues), 407.9 bits, see alignment E=3.2e-126 PF03600: CitMHS" amino acids 15 to 377 (363 residues), 102.5 bits, see alignment E=1.4e-33

Best Hits

Swiss-Prot: 40% identical to CITM_BACSU: Mg(2+)/citrate complex secondary transporter (citM) from Bacillus subtilis (strain 168)

KEGG orthology group: K03300, citrate-Mg2+:H+ or citrate-Ca2+:H+ symporter, CitMHS family (inferred from 100% identity to rru:Rru_A1475)

Predicted SEED Role

"Uncharacterized transporter, similarity to citrate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUB9 at UniProt or InterPro

Protein Sequence (433 amino acids)

>Rru_A1475 Citrate transporter (NCBI) (Rhodospirillum rubrum S1H)
MLALLGLATILALLVAIMTNKLSPLVALIIIPVAASLIGGFGVETTKFIVSGIKDIAPVA
AMFVFAIVFFGIVTDAGMMDPIIDRILRFVGLRPTRIVMGSALLALIIHLDGSGAVTFLV
TIPAMLPLFDRLGMDKRILALVVSLAAGVNFLPWTGPVLRASAALKVPVTDIFSPLVFVQ
LVGLVFVFSVAYVLGKREEKRLGLTGAKGESADIHARVLSAEEEKVRRPHLFWANIALTA
VILGTMISGVVDASVMFMIGTVLALILNYPGVKDQKARVDAHAKAALMMASILFAAGAFT
GIMRGTGMLTAMATSAAGFVPAEFASHMPFAVGIASMPLSMLFDPDSYYFGVMPVIAHVY
QSFGGAPIEIAQASILGQMTTGFPVSPLTPATFLVVGLCGISLGEHQKFAIPYLFAATVL
MTVTAALIGVFPF