Protein Info for Rru_A1447 in Rhodospirillum rubrum S1H

Annotation: Arsenite-transporting ATPase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 TIGR04291: arsenical pump-driving ATPase" amino acids 7 to 570 (564 residues), 750 bits, see alignment E=1.8e-229 PF02374: ArsA_ATPase" amino acids 8 to 292 (285 residues), 162.5 bits, see alignment E=8.9e-51 amino acids 330 to 467 (138 residues), 102.6 bits, see alignment E=1.5e-32 PF01656: CbiA" amino acids 11 to 182 (172 residues), 36.4 bits, see alignment E=2.8e-12 amino acids 331 to 399 (69 residues), 42 bits, see alignment E=5.1e-14 TIGR00345: transport-energizing ATPase, TRC40/GET3/ArsA family" amino acids 12 to 291 (280 residues), 215 bits, see alignment E=1.7e-67 PF13614: AAA_31" amino acids 13 to 152 (140 residues), 32.8 bits, see alignment E=4.2e-11 amino acids 331 to 374 (44 residues), 27.4 bits, see alignment 1.9e-09 PF10609: ParA" amino acids 330 to 362 (33 residues), 27.6 bits, see alignment (E = 1.1e-09)

Best Hits

KEGG orthology group: K01551, arsenite-transporting ATPase [EC: 3.6.3.16] (inferred from 100% identity to rru:Rru_A1447)

Predicted SEED Role

"Arsenical pump-driving ATPase (EC 3.6.3.16)" in subsystem Arsenic resistance (EC 3.6.3.16)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUE7 at UniProt or InterPro

Protein Sequence (571 amino acids)

>Rru_A1447 Arsenite-transporting ATPase (NCBI) (Rhodospirillum rubrum S1H)
MALPETPTRFIFFTGKGGVGKTSLSCASGLALAEAGKTVLIVSTDPASNLDEVLGTPLGD
QPTAIAGAPGLYGLNIDPEAAAFAYRERMVAPYRGLLPAAAIASMEEQFSGACTVEIAAF
DAFAKLLGDDAATAAFDHVIFDTAPTGHTLRLLTLPSAWGDFIASATGGASCLGPLAGLE
TQKALYGATVAHLADPKMTTVVLVSRAEGAALREAERTRGELADLGVTNQRLALNGVFTA
PRGEDAIADAMTLRGLEALADMPAALAALPRSQTPFLPLGTVGLTALRQIAADTAAEATP
AGPAPAAAFPSLPGGLEDLIDEIAAAGHGVVMTMGKGGVGKTTIAAALAIALARRGHRVT
LSTTDPAAHVAQAVDGTVPGLTIARIDPKVEIAGYRAEVLEKAGKNLDAAGRAMLEEDLR
SPCTEEIAVFQAFARTVDGGKDHFVVLDTAPTGHTILLLDAAEAYHREVLRTRADMPEAV
RALLPRLRDPGFTKAIIVTLAEATPVHEAERLQRDLARAGITPFAWVITQSLLASGTTDR
LLRQRGAYEAPFIARVATELAKRTALIPWAA