Protein Info for Rru_A1437 in Rhodospirillum rubrum S1H

Annotation: Sodium:dicarboxylate symporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 19 to 38 (20 residues), see Phobius details amino acids 58 to 76 (19 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 153 to 178 (26 residues), see Phobius details amino acids 195 to 219 (25 residues), see Phobius details amino acids 229 to 253 (25 residues), see Phobius details amino acids 316 to 333 (18 residues), see Phobius details amino acids 341 to 386 (46 residues), see Phobius details PF00375: SDF" amino acids 20 to 412 (393 residues), 389.5 bits, see alignment E=9.1e-121

Best Hits

Swiss-Prot: 100% identical to DCTA_RHORT: C4-dicarboxylate transport protein (dctA) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 100% identity to rru:Rru_A1437)

MetaCyc: 62% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate, aspartate"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUF7 at UniProt or InterPro

Protein Sequence (447 amino acids)

>Rru_A1437 Sodium:dicarboxylate symporter (NCBI) (Rhodospirillum rubrum S1H)
MAFVVPAAPPRTPHKFYQILYVQVLVAIVAGVLLGHFYPDLGSALKPLGDAFIKLVKMII
APVIFLTVVTGIAGLTDMQKVGRVAGKAMIYFLSFSTLALIIGMIVANVVHPGSGLNIDP
ASLDAKAVQTYTSHAHDQSLVGFLMNIIPSTPISAFASGDILQVLFFAVLFGIALATVGE
RGKPVLDLLNPLLQVVFRLVAIVMKAAPLGAFGAMAFTIGKYGIGSIANLAMLVGTFYLT
SGLFVFVVLGLVARYNGFSLLALLRYIKEELLLVLGTSSSEAALPTLMEKLERAGCKKSV
VGLVVPTGYSFNLDGTNIYMTLAALFIAQATNIDLSLQDQILLLLVAMLSSKGAAGITGA
GFITLAATLSVVPSVPVAGMALILGVDRFMSECRALTNFIGNAVATIVVAKWEGELDRDR
LALALKGGGKALLPLEHEAAIHIPSKV