Protein Info for Rru_A1426 in Rhodospirillum rubrum S1H

Annotation: 4Fe-4S ferredoxin, iron-sulfur binding (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 PF13247: Fer4_11" amino acids 59 to 163 (105 residues), 41.7 bits, see alignment E=4.4e-14 PF12837: Fer4_6" amino acids 89 to 111 (23 residues), 26.2 bits, see alignment (E = 2.2e-09) PF00037: Fer4" amino acids 90 to 112 (23 residues), 34.3 bits, see alignment (E = 5.9e-12) PF12838: Fer4_7" amino acids 95 to 158 (64 residues), 27.3 bits, see alignment E=1.6e-09

Best Hits

Swiss-Prot: 100% identical to COOF_RHORU: Iron-sulfur protein (cooF) from Rhodospirillum rubrum

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1426)

MetaCyc: 100% identical to CooF ferredoxin-type iron-sulfur protein (Rhodospirillum rubrum)
1.2.7.4,2.3.3.M4,2.3.3.M4,2.3.3.M5 [EC: 1.2.7.4, 2.3.3.M4, 2.3.3.M5]

Predicted SEED Role

"CO dehydrogenase iron-sulfur protein CooF (EC 1.2.99.2)" in subsystem Carbon monoxide induced hydrogenase (EC 1.2.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.99.2

Use Curated BLAST to search for 1.2.7.4 or 1.2.99.2 or 2.3.3.M4 or 2.3.3.M5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUG8 at UniProt or InterPro

Protein Sequence (190 amino acids)

>Rru_A1426 4Fe-4S ferredoxin, iron-sulfur binding (NCBI) (Rhodospirillum rubrum S1H)
MPPIKENVIIYANPDHCLSCHSCELACAVAHSGGHDMIEAIAANLPLHARNKVVSVDGTA
MPMQCRQCEDAPCTFACPTGACRQADGQVQIVEQHCIGCKLCVMVCPFGAITVRSETVVE
QGACTNRGVAKKCDLCVDWRASTGKTAPACVEACPTKAIRMVDLDAYRIALREARAREIA
KSHRHMRVQF