Protein Info for Rru_A1412 in Rhodospirillum rubrum S1H

Annotation: 4Fe-4S ferredoxin, iron-sulfur binding (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02589: LUD_dom
  • amino acids 77 to 302 (226 residues), 159.2 bits, E=3.2e-50
• PF13183: Fer4_8
  • amino acids 319 to 385 (67 residues), 43.5 bits, E=1.1e-14
• PF11870: LutB_C
  • amino acids 393 to 480 (88 residues), 63.6 bits, E=5.4e-21

Best Hits

Swiss-Prot: 41% identical to LUTB_BACSU: Lactate utilization protein B (lutB) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1412)

MetaCyc: 41% identical to component of an iron-sulfur oxidase linked to L-lactate utilization (Bacillus subtilis subtilis 168)
L-lactate dehydrogenase. [EC: 1.1.1.27]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

MetaCyc Pathways

• homolactic fermentation (11/12 steps found)
• Bifidobacterium shunt (13/15 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• pyruvate fermentation to acetate and lactate II (4/4 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• pyruvate fermentation to (S)-lactate (1/1 steps found)
• superpathway of glucose and xylose degradation (12/17 steps found)
• heterolactic fermentation (11/18 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.27

Sequence Analysis Tools

See Q2RUI2 at UniProt or InterPro

Protein Sequence (484 amino acids)

>Rru_A1412 4Fe-4S ferredoxin, iron-sulfur binding (NCBI) (Rhodospirillum rubrum S1H)
MNAPLPQDTAATAPLAFTGKARVALNDPRLRANFRRAMDGLMSKRAAQFADADEWRTLRA
RGAEARARALAKLPDLLERLERRCAENAITVHWAETTGQANAIVLDLLTAAGAKTVIKGK
SMVSEEMHLNAHLAAHGITAIESDLGEYIIQLAGEAPSHIVMPCIHKNKAEIAALFAEHI
PGQPYTENVDDLTGAARNALRGAFAAADAGISGVNFAVAETGTLVLIENEGNGRLSTTLP
PLHIAVTGIEKVLEFLDDVPPLLSLLPRSATGQPITTYVNMISGPRRPGEKDGPQAVHLV
LLDNGRSRVYDDPQLRDTLRCIRCAACLNHCPVYTRVGGHSYSFTYPGPIGKILSPQLEG
LDCAGDQPHASSLCGACAEVCPVEIPIPDLLVRLRGEAISPTSRAVKGGGSARSLGDRLG
RRLSTAILGQPRLYGLISRLAGRIGDRLPSWLPGLNRWTRVRSKPAFARRSLHALARERG
YADE