Protein Info for Rru_A1412 in Rhodospirillum rubrum S1H

Annotation: 4Fe-4S ferredoxin, iron-sulfur binding (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 PF02589: LUD_dom" amino acids 77 to 302 (226 residues), 159.2 bits, see alignment E=3.2e-50 PF13183: Fer4_8" amino acids 319 to 385 (67 residues), 43.5 bits, see alignment E=1.1e-14 PF11870: LutB_C" amino acids 393 to 480 (88 residues), 63.6 bits, see alignment E=5.4e-21

Best Hits

Swiss-Prot: 41% identical to LUTB_BACSU: Lactate utilization protein B (lutB) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1412)

MetaCyc: 41% identical to component of an iron-sulfur oxidase linked to L-lactate utilization (Bacillus subtilis subtilis 168)
L-lactate dehydrogenase. [EC: 1.1.1.27]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUI2 at UniProt or InterPro

Protein Sequence (484 amino acids)

>Rru_A1412 4Fe-4S ferredoxin, iron-sulfur binding (NCBI) (Rhodospirillum rubrum S1H)
MNAPLPQDTAATAPLAFTGKARVALNDPRLRANFRRAMDGLMSKRAAQFADADEWRTLRA
RGAEARARALAKLPDLLERLERRCAENAITVHWAETTGQANAIVLDLLTAAGAKTVIKGK
SMVSEEMHLNAHLAAHGITAIESDLGEYIIQLAGEAPSHIVMPCIHKNKAEIAALFAEHI
PGQPYTENVDDLTGAARNALRGAFAAADAGISGVNFAVAETGTLVLIENEGNGRLSTTLP
PLHIAVTGIEKVLEFLDDVPPLLSLLPRSATGQPITTYVNMISGPRRPGEKDGPQAVHLV
LLDNGRSRVYDDPQLRDTLRCIRCAACLNHCPVYTRVGGHSYSFTYPGPIGKILSPQLEG
LDCAGDQPHASSLCGACAEVCPVEIPIPDLLVRLRGEAISPTSRAVKGGGSARSLGDRLG
RRLSTAILGQPRLYGLISRLAGRIGDRLPSWLPGLNRWTRVRSKPAFARRSLHALARERG
YADE