Protein Info for Rru_A1400 in Rhodospirillum rubrum S1H
Annotation: CheW protein (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K03408, purine-binding chemotaxis protein CheW (inferred from 100% identity to rru:Rru_A1400)Predicted SEED Role
"Positive regulator of CheA protein activity (CheW)" in subsystem Bacterial Chemotaxis or Two-component regulatory systems in Campylobacter
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2RUJ4 at UniProt or InterPro
Protein Sequence (170 amino acids)
>Rru_A1400 CheW protein (NCBI) (Rhodospirillum rubrum S1H) MSLWNGGRSLEVLTLGLAGEIFAIEASHVREILDLVPITEVPNSAAFVSGLINVRGKVVP LADLRLKFGMEQKPPTIDTRIVVIEVLVDGDPLIVGIRADKVYEITQVAAGALEETPRIG MRWRSDYITCIGKRDADFIVVLDIGRIFSQGESRDEAIFAGSSTAPRSLS