Protein Info for Rru_A1395 in Rhodospirillum rubrum S1H

Annotation: Nitrogenase iron protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 TIGR01287: nitrogenase iron protein" amino acids 3 to 274 (272 residues), 460.9 bits, see alignment E=6.9e-143 PF00142: Fer4_NifH" amino acids 3 to 273 (271 residues), 398.2 bits, see alignment E=2e-123 PF01656: CbiA" amino acids 6 to 227 (222 residues), 35.9 bits, see alignment E=6.7e-13

Best Hits

Swiss-Prot: 84% identical to NIFH3_AZOVI: Nitrogenase iron protein 3 (anfH) from Azotobacter vinelandii

KEGG orthology group: K02588, nitrogenase iron protein NifH [EC: 1.18.6.1] (inferred from 100% identity to rru:Rru_A1395)

MetaCyc: 84% identical to [FeFe]-nitrogenase complex nitrogenase reductase component monomer (Azotobacter vinelandii)

Predicted SEED Role

"Nitrogenase (iron-iron) reductase and maturation protein AnfH" in subsystem Nitrogen fixation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.18.6.1

Use Curated BLAST to search for 1.18.6.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUJ9 at UniProt or InterPro

Protein Sequence (275 amino acids)

>Rru_A1395 Nitrogenase iron protein (NCBI) (Rhodospirillum rubrum S1H)
MTRKIAIYGKGGIGKSTTTQNTAAAMAHFHHKKIFIHGCDPKADSTRLILGGKPQETLMD
VLREQGAEKVTYDKVVRKGYMDIQCVESGGPEPGVGCAGRGVITAIDLMEAQGAYTSDLD
FVFFDVLGDVVCGGFAMPIRDGKAQEVYIVASGEMMAVYAANNICKGLVKYAKQSGVRLG
GIICNSRKVDGEREFIEEFTKAIGTTMIHFVPRDNIVQKAEFNKKTVTEYEPTENQANEY
SLLAQAIIENDNFVIPKPMTMDELESMVEKYGLLD