Protein Info for Rru_A1388 in Rhodospirillum rubrum S1H

Annotation: Transcriptional Regulator, NifA subfamily, Fis Family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 PF01590: GAF" amino acids 47 to 186 (140 residues), 38.7 bits, see alignment E=4.9e-13 PF13185: GAF_2" amino acids 51 to 188 (138 residues), 39.4 bits, see alignment E=2.4e-13 PF00158: Sigma54_activat" amino acids 220 to 386 (167 residues), 245.7 bits, see alignment E=7.3e-77 PF14532: Sigma54_activ_2" amino acids 221 to 391 (171 residues), 70.8 bits, see alignment E=4.9e-23 PF07728: AAA_5" amino acids 244 to 363 (120 residues), 30.3 bits, see alignment E=1.3e-10 PF00004: AAA" amino acids 244 to 380 (137 residues), 24 bits, see alignment E=1.6e-08 PF02954: HTH_8" amino acids 483 to 523 (41 residues), 43.9 bits, see alignment 5.5e-15

Best Hits

Swiss-Prot: 66% identical to ANFA_AZOVI: Nitrogen fixation protein AnfA (anfA) from Azotobacter vinelandii

KEGG orthology group: K02584, Nif-specific regulatory protein (inferred from 100% identity to rru:Rru_A1388)

Predicted SEED Role

"Nitrogenase (iron-iron) transcriptional regulator" in subsystem Nitrogen fixation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUK6 at UniProt or InterPro

Protein Sequence (533 amino acids)

>Rru_A1388 Transcriptional Regulator, NifA subfamily, Fis Family (NCBI) (Rhodospirillum rubrum S1H)
MLMDYTYAIDLDDFVDDSTDCKTGECRVAVLPILFQISQIISESEDLPRSLAIILKVMQQ
RMRIGRGTVSLYDRESGKIFVHESFGGRDDQQALGASGPGRGITAKVVDSGKAIIVPELR
DSPTKPNRTQLQADGSDLAVSFFCVPILRGRKVLGTISAERVYANRRLLKQDVELIATIA
SMIAPAVELYLLENIDKVRLENENRRLHDALKSRFKPTNIIGTSKPMQEVYDLIHKVAMT
KATVLILGESGVGKELVASAIHYNGATAEGPFIKFNCAALPESLGESELFGHEKGAFTGA
IAQRKGRFEMADGGTIFLDEVGELSLAMQAKLLRVLQEKTFERVGGGRSVRVDVRIIAAT
NRNLPEMVEKGTFREDLFYRLNVFPITLPPLRDRGSDVILLVDHFIARHAAEGGREAKRV
STPALTMLMAYHWPGNVRELENVIERSVILSEDGVIHGYNLPPSLQTATETGTSFGCGLE
AKLQAVEYEMIVEALKTHGGNATEAAKELGLTRRILGLRMEKYALNYKTYRKR