Protein Info for Rru_A1383 in Rhodospirillum rubrum S1H

Annotation: Acetate CoA-transferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02429: 3-oxoacid CoA-transferase, A subunit
  • amino acids 4 to 215 (212 residues), 229.7 bits, E=1.4e-72
• PF01144: CoA_trans
  • amino acids 6 to 214 (209 residues), 207.1 bits, E=1.2e-65

Best Hits

Swiss-Prot: 56% identical to ATOD_HAEIN: Acetate CoA-transferase subunit alpha (atoD) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K01034, acetate CoA-transferase alpha subunit [EC: 2.8.3.8] (inferred from 100% identity to rru:Rru_A1383)

MetaCyc: 55% identical to acetyl-CoA:acetoacetyl-CoA transferase subunit alpha (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Acetyl-CoA:acetoacetyl-CoA transferase, alpha subunit (EC 2.8.3.8)" in subsystem Acetyl-CoA fermentation to Butyrate (EC 2.8.3.8)

MetaCyc Pathways

• acetyl-CoA fermentation to butanoate (6/7 steps found)
• acetoacetate degradation (to acetyl CoA) (2/2 steps found)
• pyruvate fermentation to acetone (4/5 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (7/10 steps found)
• L-glutamate degradation XI (reductive Stickland reaction) (4/7 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (11/17 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (8/13 steps found)
• gallate degradation III (anaerobic) (5/11 steps found)
• 4-aminobutanoate degradation V (2/7 steps found)
• succinate fermentation to butanoate (2/7 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Butanoate metabolism
• Propanoate metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.8

Use Curated BLAST to search for 2.8.3.8

Sequence Analysis Tools

See Q2RUL1 at UniProt or InterPro

Protein Sequence (217 amino acids)

>Rru_A1383 Acetate CoA-transferase (NCBI) (Rhodospirillum rubrum S1H)
MSKVVSIRDAVERIPDGASIMIGGFMGVGSPHRLIDELVRQGKRDLTIIANDTARPNHAI
GKLIDAGAVSRLIASHIGLNPETQRRMIAGEIDVTLVPQGTLAEQIRAGGTGLGGVLTPT
GVGTLVQDGKQTVDVDGTVFLLEKPIKADFALIHAWRADHLGNLQYELTARNFNPSMAMA
AATVIAEAQTIVPVGVIPPDQVETVSIIVDLIVAREA