Protein Info for Rru_A1351 in Rhodospirillum rubrum S1H

Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details amino acids 39 to 39 (1 residues), see Phobius details transmembrane" amino acids 38 to 38 (1 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 124 to 143 (20 residues), see Phobius details amino acids 181 to 204 (24 residues), see Phobius details amino acids 210 to 232 (23 residues), see Phobius details amino acids 244 to 270 (27 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details amino acids 369 to 389 (21 residues), see Phobius details amino acids 400 to 419 (20 residues), see Phobius details amino acids 430 to 454 (25 residues), see Phobius details PF11299: DUF3100" amino acids 33 to 273 (241 residues), 300.7 bits, see alignment E=3.5e-94

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1351)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUP3 at UniProt or InterPro

Protein Sequence (456 amino acids)

>Rru_A1351 hypothetical protein (NCBI) (Rhodospirillum rubrum S1H)
MRTADRMAMPRASSGLAADTIKVFACTALCVLVAETIGNVSVPLGGSYKVVLLPLLWALL
LGAVWGLAANRLPAPVRIAKRHQTLAALLLQPALMLFIGKLGLMVGGNLPKIFDAGWALV
FQEFGHFFGTMIFGLPVALLLGIKREAIGATFSVGREPSLAIIGEKYGMDSPEGRGVLAE
YMTGTIFGAIFISIFAGFIAGLGLFDPRALAMGAGVGSGSLMAAASGAIAALQTPEIAKD
VVTFAAASNLVTTTIGTYFTLFLSLPFTVWAYGVLEPILGRFGRAASPAAEPAAAAAKTA
AAAPQEAAPAAKLSPATILTVWIIAGLMALIGNTITYKIIPDAAVFAGLAILLGTVIVGY
GAYVATRKVVPAVVWVSLVAMALTYPGTPYAAEITALTGKLNFMALATPLLAFAGLSIAK
DVPAFRKLGWRIVVVSLMANAGTFLGATLIAQFFMH