Protein Info for Rru_A1333 in Rhodospirillum rubrum S1H

Annotation: BioY protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 signal peptide" amino acids 12 to 15 (4 residues), see Phobius details transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 77 to 99 (23 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details PF02632: BioY" amino acids 1 to 135 (135 residues), 110.9 bits, see alignment E=2.6e-36

Best Hits

KEGG orthology group: K03523, putative biotin biosynthesis protein BioY (inferred from 100% identity to rru:Rru_A1333)

Predicted SEED Role

"Substrate-specific component BioY of biotin ECF transporter" in subsystem Biotin biosynthesis or ECF class transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUR1 at UniProt or InterPro

Protein Sequence (144 amino acids)

>Rru_A1333 BioY protein (NCBI) (Rhodospirillum rubrum S1H)
MGVMLAGAILGAKRGGLAIVLLLALVAVGLPLLSGGRGGLGVFFGPTGGFLFGWVAGAFV
VGALHEWGWRGLTPLRSFAYAVIGGVGVVYTIGVPWVAINADLPLLKAAIASAPFLPGDL
IKAGLAALIAVTVKRSFPLISKAA