Protein Info for Rru_A1311 in Rhodospirillum rubrum S1H

Annotation: Transcriptional Regulator, MerR family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 PF13411: MerR_1" amino acids 5 to 70 (66 residues), 60.2 bits, see alignment E=2.6e-20 PF00376: MerR" amino acids 14 to 41 (28 residues), 35.2 bits, see alignment 1.3e-12 PF09278: MerR-DNA-bind" amino acids 46 to 112 (67 residues), 49.3 bits, see alignment E=9.3e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1311)

Predicted SEED Role

"Predicted transcriptional regulator LiuR of leucine degradation pathway, MerR family" in subsystem HMG CoA Synthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUT3 at UniProt or InterPro

Protein Sequence (132 amino acids)

>Rru_A1311 Transcriptional Regulator, MerR family (NCBI) (Rhodospirillum rubrum S1H)
MDTLYSVTDLGRSLGITPRTIRFYEDKGLISPRRVGTTRVYTAKDRARMTLILRGKSLGF
TLRDIKEFLDLYATDKTQVEQITLLLAKVRQRVAQLEEQRQAVETSLRELRDIERQSLEA
LKAKGVNPHPQG