Protein Info for Rru_A1297 in Rhodospirillum rubrum S1H

Annotation: Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 81 to 81 (1 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 13 to 109 (97 residues), 100.6 bits, see alignment E=2.9e-33 PF00528: BPD_transp_1" amino acids 33 to 215 (183 residues), 69.1 bits, see alignment E=2.1e-23

Best Hits

Swiss-Prot: 31% identical to ARTQ_BACSU: Arginine transport system permease protein ArtQ (artQ) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1297)

Predicted SEED Role

"Cystine ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUU7 at UniProt or InterPro

Protein Sequence (227 amino acids)

>Rru_A1297 Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (NCBI) (Rhodospirillum rubrum S1H)
MMENSSLLVHYGPSILRGFGVTVLCWSAGCALGIVFGFALALLRRLPFAPLRWVVRAYIE
VIRGTPFLIQLFLLYSGGPFIGLRLEATTAGILGLGIYGSAYFAEIFRGGFEAVPKGYVE
AGESLSMSPLVILRRIVVPTMLVAILPAIVNMMIILTKETVVLSIITVPELMYEMQTMAA
ETFAVFEVIFGLALFYWLLVEVVSRLGRRVEARLTRFLTDNKPGVRA