Protein Info for Rru_A1283 in Rhodospirillum rubrum S1H

Annotation: Membrane-bound tetrahaem cytochrome TorC/YecK (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 20 to 34 (15 residues), see Phobius details TIGR02162: trimethylamine-N-oxide reductase c-type cytochrome TorC" amino acids 4 to 387 (384 residues), 513 bits, see alignment E=3.1e-158 PF03264: Cytochrom_NNT" amino acids 12 to 185 (174 residues), 248.6 bits, see alignment E=4.6e-78 PF22113: Mtrc-MtrF_II-IV_dom" amino acids 46 to 186 (141 residues), 30.4 bits, see alignment E=4e-11

Best Hits

Swiss-Prot: 44% identical to TORC_ECO57: Cytochrome c-type protein TorC (torC) from Escherichia coli O157:H7

KEGG orthology group: K03532, trimethylamine-N-oxide reductase (cytochrome c) 1, cytochrome c-type subunit TorC (inferred from 100% identity to rru:Rru_A1283)

MetaCyc: 44% identical to cytochrome c menaquinol dehydrogenase TorC (Escherichia coli K-12 substr. MG1655)
RXN0-5264

Predicted SEED Role

"Cytochrome c-type protein NapC" in subsystem Nitrate and nitrite ammonification or trimethylamine N-oxide (TMAO) reductase

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUW1 at UniProt or InterPro

Protein Sequence (392 amino acids)

>Rru_A1283 Membrane-bound tetrahaem cytochrome TorC/YecK (NCBI) (Rhodospirillum rubrum S1H)
MIKRIWTVVWKPSARWGLGVLLIVGAVGGVVGWNVFHGALEHTNSIEFCISCHTMENTVF
QEYKQSPHYKNASGVRAGCPDCHVPKEGLPLYAAKLRASKDVYHEILGTIDTPQKFEDRR
LEMAQRVWARMEETDSRECRSCHSYDSMDFHAQKPKAAAMMEKAMGEGETCIACHKGIAH
KLPDMSAGYKKTFANLQALAAKEGAKAKTLINLDTKPLFLDRATASAGGKGDGKLLSGSE
VAVAERDGDWLKVTVSGWQQEGAERVIYALKGQRIFTAALDASATAAVTVTETVVDADTE
LTWKKVTLQAWLSKDAMLGDSDKLWAYGKEMYGAACGTCHSLRAPDHFLANQWIGTLKAM
KRFVSLDDEQYRFLQKYLQLNAKDTGGAGAHG