Protein Info for Rru_A1245 in Rhodospirillum rubrum S1H

Annotation: Transcriptional Regulator, Crp/Fnr family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 PF00027: cNMP_binding" amino acids 28 to 116 (89 residues), 48.3 bits, see alignment E=1.2e-16 PF13545: HTH_Crp_2" amino acids 150 to 212 (63 residues), 51.2 bits, see alignment E=1.5e-17 PF00325: Crp" amino acids 163 to 192 (30 residues), 25.8 bits, see alignment 1.1e-09

Best Hits

KEGG orthology group: K01420, CRP/FNR family transcriptional regulator, anaerobic regulatory protein (inferred from 100% identity to rru:Rru_A1245)

Predicted SEED Role

"transcriptional regulator, Crp/Fnr family" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RUZ9 at UniProt or InterPro

Protein Sequence (216 amino acids)

>Rru_A1245 Transcriptional Regulator, Crp/Fnr family (NCBI) (Rhodospirillum rubrum S1H)
MTPAFRLPGLAELDAESARVFAGAARSVQVPAGTILFRTGARCESYVLVVSGAIRVHRTS
PGGREIVLYRVEGGQSCVLTTNCLIAARDYDAEGVAETDVEMIALPAPTFRRLLAASEAF
RDFVFAAYASRLSDLLLLIEEVAFGRIDVRLAGWLAARGDQPIAITHQDLAVELGTAREV
ISRQLKDFERRGWVDLGRGIIAPRDPQALRHLAEGV