Protein Info for Rru_A1227 in Rhodospirillum rubrum S1H

Annotation: H+-transporting two-sector ATPase, delta/epsilon subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 TIGR01216: ATP synthase F1, epsilon subunit" amino acids 5 to 131 (127 residues), 103.2 bits, see alignment E=5.3e-34 PF02823: ATP-synt_DE_N" amino acids 6 to 84 (79 residues), 97.6 bits, see alignment E=1.7e-32

Best Hits

Swiss-Prot: 100% identical to ATPE_RHORU: ATP synthase epsilon chain (atpC) from Rhodospirillum rubrum

KEGG orthology group: K02114, F-type H+-transporting ATPase subunit epsilon [EC: 3.6.3.14] (inferred from 100% identity to rru:Rru_A1227)

Predicted SEED Role

"ATP synthase epsilon chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RV17 at UniProt or InterPro

Protein Sequence (134 amino acids)

>Rru_A1227 H+-transporting two-sector ATPase, delta/epsilon subunit (NCBI) (Rhodospirillum rubrum S1H)
MAETTEFELVSPERLLFSEPVEMVVVPGTDGDFGAMPRHAPLLSTVRPGVISTYNGGKVQ
RRIFVAGGFAEVTEDRCTVLADEAFDLASLSEEAVRARLQAADDRLKEATSEAEKAEAAQ
AKAIAEALLAARKG