Protein Info for Rru_A1223 in Rhodospirillum rubrum S1H

Annotation: H+-transporting two-sector ATPase, delta (OSCP) subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 186 TIGR01145: ATP synthase F1, delta subunit" amino acids 11 to 180 (170 residues), 118.2 bits, see alignment E=2.4e-38 PF00213: OSCP" amino acids 11 to 182 (172 residues), 172.8 bits, see alignment E=3.7e-55

Best Hits

Swiss-Prot: 100% identical to ATPD_RHORT: ATP synthase subunit delta (atpH) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K02113, F-type H+-transporting ATPase subunit delta [EC: 3.6.3.14] (inferred from 100% identity to rru:Rru_A1223)

MetaCyc: 32% identical to ATP synthase F1, delta subunit (Synechococcus elongatus PCC 7942 = FACHB-805)
ATPSYN-RXN [EC: 7.1.2.2]

Predicted SEED Role

"ATP synthase delta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14 or 7.1.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RV21 at UniProt or InterPro

Protein Sequence (186 amino acids)

>Rru_A1223 H+-transporting two-sector ATPase, delta (OSCP) subunit (NCBI) (Rhodospirillum rubrum S1H)
MSSHKAGVTGVAERYATALYELAEDRGALDQVSADLRSLKAMLDESGDLRRVIASPVIGR
DDQRKALTALAEKAGFHEIVRNFLGVVAAKHRSFAVPGMIGAFLERLAARRGEVTARIVS
ATALTSAQKSALTTALNKATGNTVTIDASVDPALLGGMVVRVGSRMVDSSLSTKLKRLQL
AMKGVG