Protein Info for Rru_A1209 in Rhodospirillum rubrum S1H

Annotation: Chromate transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 155 to 171 (17 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 217 to 239 (23 residues), see Phobius details amino acids 245 to 268 (24 residues), see Phobius details amino acids 281 to 308 (28 residues), see Phobius details amino acids 315 to 341 (27 residues), see Phobius details amino acids 348 to 369 (22 residues), see Phobius details amino acids 375 to 395 (21 residues), see Phobius details PF02417: Chromate_transp" amino acids 23 to 190 (168 residues), 130.1 bits, see alignment E=4.3e-42 amino acids 245 to 411 (167 residues), 102.5 bits, see alignment E=1.3e-33 TIGR00937: chromate efflux transporter" amino acids 27 to 411 (385 residues), 273.2 bits, see alignment E=2.5e-85

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 100% identity to rru:Rru_A1209)

Predicted SEED Role

"Chromate transport protein ChrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RV35 at UniProt or InterPro

Protein Sequence (416 amino acids)

>Rru_A1209 Chromate transporter (NCBI) (Rhodospirillum rubrum S1H)
MTPPPDAPAAAASPPRWRRALGVFGAFLTLGLTAFGGPIAHVGYFHRAFVVRRGWLDEAA
FAERLALCQLLPGPTSSQLGVAIGLRRAGAAGGLAAFLGFTLPSALLMAALALTLARLDG
PLAGGLIAGLTLAAVAVVADAVLGMARQLCPDRRRASLALLTLACVLAWPNDGPLAPWGQ
MMPLAVAAALGAAQGWRHRDRQATPGARVRGFPGWRWGIGFLGLAGLGFFGLPLLAALAP
TPLTTLAAALFQTGALVFGGGHVVLPLLQGTLVEGALIDGAILTTGYGLAQAMPGPLFTI
AAYLGAAIAPPGAAVGYAGVAILAIFLPGFLLLAACLPFWAALRRNPLLTGAIEAVNAAV
VGLLAAALWDLLIATAVRGGTAAALAVLTFLALRFWRAPPWLAVLIPALAGAAGML