Protein Info for Rru_A1199 in Rhodospirillum rubrum S1H

Annotation: Pyridoxal kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00687: pyridoxal kinase
  • amino acids 3 to 270 (268 residues), 182 bits, E=8e-58
• PF08543: Phos_pyr_kin
  • amino acids 73 to 232 (160 residues), 51.3 bits, E=5.6e-18

Best Hits

KEGG orthology group: K00868, pyridoxine kinase [EC: 2.7.1.35] (inferred from 100% identity to rru:Rru_A1199)

Predicted SEED Role

"Pyridoxal kinase (EC 2.7.1.35)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.7.1.35)

MetaCyc Pathways

• pyridoxal 5'-phosphate salvage II (plants) (9/9 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (11/12 steps found)
• pyridoxal 5'-phosphate salvage I (6/6 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (5/8 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.35

Use Curated BLAST to search for 2.7.1.35

Sequence Analysis Tools

See Q2RV45 at UniProt or InterPro

Protein Sequence (291 amino acids)

>Rru_A1199 Pyridoxal kinase (NCBI) (Rhodospirillum rubrum S1H)
MPVLSIQSHVCAGHVGNAAAVPALQALGREPIALNTVAFAHHPGRGRPAGRVTPAEELAT
LLAALRPLDEFRRCKALLSGYLGRPDTAEVVAEAIDSLRAITPRALVVCDPVLGDTDKGL
YVDPALPGRVGALLVPRADILMPNAFELAILSGRAPPLADLGAILEAARALVGQGPRAVI
VTSLPFEDGGIGDLLVTATASWLARGPLIAGVAGIKGTGDLLSALLVGHLLRDAGDPWHP
QALPRALALAVAGVRLVLGATAGSGRGEMALVRCLPALASPLDPVPIAPLA