Protein Info for Rru_A1182 in Rhodospirillum rubrum S1H

Annotation: MiaB-like tRNA modifying enzyme (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 TIGR01579: MiaB-like tRNA modifying enzyme" amino acids 25 to 412 (388 residues), 425.7 bits, see alignment E=2.5e-131 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 25 to 435 (411 residues), 348.2 bits, see alignment E=6.5e-108 PF00919: UPF0004" amino acids 25 to 109 (85 residues), 64.8 bits, see alignment E=6.1e-22 PF04055: Radical_SAM" amino acids 162 to 333 (172 residues), 80.4 bits, see alignment E=1.8e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1182)

Predicted SEED Role

"tRNA-t(6)A37 methylthiotransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RV62 at UniProt or InterPro

Protein Sequence (441 amino acids)

>Rru_A1182 MiaB-like tRNA modifying enzyme (NCBI) (Rhodospirillum rubrum S1H)
MTATPLAPPTADAIDDNASPGGPRIVTFGCRLNTYESEVMREQAAKAGLSDAIIVNTCAV
TREAERQARQTIRRLRRENPETRLIVTGCGAQLDPKGWGAMPEVDQVLGNEEKLKAESYR
PLAGGLDLGAPEKILVDDIMTVRETALHLVGGFEGRARAFVQVQQGCDHRCTFCIIPFAR
GNSRSVPMGRIVDQIRALVAAGYREVVLTGVDITAYGPDLPGAPSLGQMVRRLLRAVPDL
PRLRLSSLDPVEVDEDLLALVASEPRLLAHLHLSVQAGADLILKRMKRRHLRDDVIALAQ
RLRTLRPGMALGADIIVGFPTETEEHFAQSLALVEEAGLTHLHVFPYSPRPGTPAALMPQ
VDKAVVKDRARRLREAGEAALAAHRAVLVGGIDHVLIERPGEGHGETFVPVSVDPALTPG
SIVPVRLRAGEGGHLIGEAVS