Protein Info for Rru_A1181 in Rhodospirillum rubrum S1H

Annotation: Cell division transporter substrate-binding protein FtsY (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 PF02881: SRP54_N" amino acids 223 to 283 (61 residues), 39.5 bits, see alignment E=8.2e-14 TIGR00064: signal recognition particle-docking protein FtsY" amino acids 232 to 502 (271 residues), 331.9 bits, see alignment E=1.5e-103 PF06414: Zeta_toxin" amino acids 301 to 409 (109 residues), 27.2 bits, see alignment E=3.9e-10 PF00448: SRP54" amino acids 303 to 503 (201 residues), 237.3 bits, see alignment E=1.8e-74

Best Hits

KEGG orthology group: K03110, fused signal recognition particle receptor (inferred from 100% identity to rru:Rru_A1181)

Predicted SEED Role

"Signal recognition particle receptor protein FtsY (=alpha subunit) (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division or Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RV63 at UniProt or InterPro

Protein Sequence (506 amino acids)

>Rru_A1181 Cell division transporter substrate-binding protein FtsY (NCBI) (Rhodospirillum rubrum S1H)
MSEHSANQRKKKGTAVAVPTSLESRPRRRIDPLAHKKRGFWSTLFWTIVGPVSFDVAEAE
LAAAEQAELAALAPPAAAPPTTPKRPLSAPPPLAKPRPEARPTPPKPVVVPSAKPEPKPV
AVPPPAAKPPVAKPSIPKPAPPPPVPPTAPPPATAPEALVPESLPEVIAPQITPEAAPPV
VPEAIPEFWPEVLPEPVAEPVKVSFFARLRGGLSRTSGKLVGGIMGLVSERKLDDQALED
LEDLLITADIGVETAGKLTRSLAKERFGKNVTGEEIRGHFADEIATILGPVARPLEIDGS
LKPHVVLVVGVNGSGKTTTIGKIANQLVHENKRVLLAAGDTFRAAAVEQLRIWGDRTGCE
VIARDTGADSAGLAFDALQKARAEGYDVLLIDTAGRLHNKTELMEELKKVVRVLRKIDPA
VPHTCLQVLDATVGQNAHQQVKVFQEMTDVSGLVMTKLDGTAKGGVVVALADKFGLPVHY
VGIGEGIDDLRPFSARDFARGLMDLD