Protein Info for Rru_A1164 in Rhodospirillum rubrum S1H

Annotation: Peptidase M52, hydrogenase expression/formation protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 TIGR00072: hydrogenase maturation protease" amino acids 21 to 166 (146 residues), 138.2 bits, see alignment E=2e-44 TIGR00140: hydrogenase expression/formation protein" amino acids 21 to 171 (151 residues), 179.7 bits, see alignment E=3.4e-57 PF01750: HycI" amino acids 37 to 164 (128 residues), 115.6 bits, see alignment E=7.1e-38

Best Hits

Swiss-Prot: 61% identical to HUPD_BRADU: Hydrogenase expression/formation protein HupD (hupD) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K03605, hydrogenase 1 maturation protease [EC: 3.4.24.-] (inferred from 100% identity to rru:Rru_A1164)

MetaCyc: 42% identical to hydrogenase 2 maturation protease (Escherichia coli K-12 substr. MG1655)
RXN-22655 [EC: 3.4.23.51]

Predicted SEED Role

"Hydrogenase maturation protease (EC 3.4.24.-)" in subsystem Membrane-bound Ni, Fe-hydrogenase (EC 3.4.24.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.23.51 or 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RV80 at UniProt or InterPro

Protein Sequence (198 amino acids)

>Rru_A1164 Peptidase M52, hydrogenase expression/formation protein (NCBI) (Rhodospirillum rubrum S1H)
MNIPGGLPLAREEDEEDCAALVLGIGNLLWADEGFGVRCVEEMHATCDLAPGVRLLDGGT
QGLYLVGAIARAARLIVFDAIDYGEAPGTLKVVFGEEVAGFMGCRKMSLHQTGFQDVLAA
ADLLGRRPPVMALIGVQAEALDDWGGPLRPVVRAQVGPAIAQACALLAEWGLACRPRPAA
PAAGLLGFGLSSSAYEQR