Protein Info for Rru_A1146 in Rhodospirillum rubrum S1H

Annotation: 5-aminolevulinic acid synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 TIGR01821: 5-aminolevulinic acid synthase" amino acids 4 to 397 (394 residues), 591.1 bits, see alignment E=5.2e-182 PF00155: Aminotran_1_2" amino acids 48 to 391 (344 residues), 232.1 bits, see alignment E=1.2e-72 PF01041: DegT_DnrJ_EryC1" amino acids 94 to 221 (128 residues), 20.1 bits, see alignment E=3.3e-08

Best Hits

Swiss-Prot: 62% identical to HEM1_RHIRD: 5-aminolevulinate synthase (hemA) from Rhizobium radiobacter

KEGG orthology group: K00643, 5-aminolevulinate synthase [EC: 2.3.1.37] (inferred from 100% identity to rru:Rru_A1146)

MetaCyc: 56% identical to 5-aminolevulinate synthase 2 (Cereibacter sphaeroides)
5-aminolevulinate synthase. [EC: 2.3.1.37]

Predicted SEED Role

"5-aminolevulinate synthase (EC 2.3.1.37)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 2.3.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.37

Use Curated BLAST to search for 2.3.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RV98 at UniProt or InterPro

Protein Sequence (421 amino acids)

>Rru_A1146 5-aminolevulinic acid synthase (NCBI) (Rhodospirillum rubrum S1H)
MTLFNYQDFFTNELTQLHREGRYRVFADLERETRSGIHALDHRTGKRVTIWCSNDYLSMG
VHPDVITAALGALEHYGAGAGGTRNISGTSHEHVLLERELADLHGKQSALLFTSGYVAND
AALSSLGRLLPGCVIFSDALNHASMIEGIRRSGAEKRVFAHNDWHDLERQLASVDPHRPK
LICFESCYSMDGDFAPMEAICDLAEKHTAFTYVDEVHAVGLYGARGAGIAERDGLLDRID
MFQGTLSKGFGAMGGYIAGSLEAVDFVRGFAPGFIFSSALPPCVVAGIRAALHHLKEDDT
PRRALARRTASLKAKMQANAIPALPSPSHIVPVMIGDAALAKAITDRLMVEHGIYIQPIN
YPTVPRGTERLRITPTPLHTDEDEDTLVAALVAIRQEFPRWRELAQAARPDPSALGRGDV
A