Protein Info for Rru_A1142 in Rhodospirillum rubrum S1H

Annotation: Glycine hydroxymethyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 PF00464: SHMT" amino acids 24 to 400 (377 residues), 530.9 bits, see alignment E=1.7e-163 PF00155: Aminotran_1_2" amino acids 97 to 340 (244 residues), 24.1 bits, see alignment E=2e-09

Best Hits

Swiss-Prot: 100% identical to GLYA1_RHORT: Serine hydroxymethyltransferase 1 (glyA1) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00600, glycine hydroxymethyltransferase [EC: 2.1.2.1] (inferred from 100% identity to rru:Rru_A1142)

MetaCyc: 65% identical to serine hydroxymethyltransferase subunit (Hyphomicrobium methylovorum GM2)
Glycine hydroxymethyltransferase. [EC: 2.1.2.1]

Predicted SEED Role

"Serine hydroxymethyltransferase (EC 2.1.2.1)" in subsystem Folate Biosynthesis or Glycine Biosynthesis or Glycine and Serine Utilization or LMPTP YwlE cluster or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle or Serine Biosynthesis (EC 2.1.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.1

Use Curated BLAST to search for 2.1.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVA2 at UniProt or InterPro

Protein Sequence (434 amino acids)

>Rru_A1142 Glycine hydroxymethyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MEASVAPPALRNAPCAGVNAACLSAADDAVAIAIAQETTRQRESIELIASENFVSKAVLE
AQGSVLTNKYAEGYPQRRYYGGCANVDRVEDLAIARLNQLFGSTYANVQPHSGSQANQAV
FLALLAPGDTILGLDLKAGGHLTHGAPVNISGRWFTAVSYGVDPRTHLIDMEQMADLARR
HRPKLLIAGGSAYPRLLDFARFRQIADEVGAILMVDMAHFAGLVAGGVYPSPVPFADVIT
STTHKTLRGPRGGFVLTNDAAIAKKINSAVFPGLQGGPLMHIIAAKAVAFGEALDPSFKI
YARRVVENCRVLAQTLLDGGLAITSGGTDCHLAVVDLRPLGVTGTIAEQALESIGITLNK
NAIPNDPEKPMVTSGIRVGSAAGTSRGFGPEEYRRIAALILETLHAVRAGTLEADREGIR
TRVRSLVAGFPLPY