Protein Info for Rru_A1142 in Rhodospirillum rubrum S1H

Annotation: Glycine hydroxymethyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00464: SHMT
  • amino acids 24 to 400 (377 residues), 530.9 bits, E=1.7e-163
• PF00155: Aminotran_1_2
  • amino acids 97 to 340 (244 residues), 24.1 bits, E=2e-09

Best Hits

Swiss-Prot: 100% identical to GLYA1_RHORT: Serine hydroxymethyltransferase 1 (glyA1) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00600, glycine hydroxymethyltransferase [EC: 2.1.2.1] (inferred from 100% identity to rru:Rru_A1142)

MetaCyc: 65% identical to serine hydroxymethyltransferase subunit (Hyphomicrobium methylovorum GM2)
Glycine hydroxymethyltransferase. [EC: 2.1.2.1]

Predicted SEED Role

"Serine hydroxymethyltransferase (EC 2.1.2.1)" in subsystem Folate Biosynthesis or Glycine Biosynthesis or Glycine and Serine Utilization or LMPTP YwlE cluster or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle or Serine Biosynthesis (EC 2.1.2.1)

MetaCyc Pathways

• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• folate transformations III (E. coli) (7/9 steps found)
• folate polyglutamylation (4/5 steps found)
• glycine biosynthesis I (1/1 steps found)
• dTMP de novo biosynthesis (mitochondrial) (2/3 steps found)
• glycine degradation (2/3 steps found)
• photorespiration I (6/9 steps found)
• photorespiration III (6/9 steps found)
• folate transformations II (plants) (7/11 steps found)
• photorespiration II (6/10 steps found)
• folate transformations I (8/13 steps found)
• glycine betaine degradation I (4/8 steps found)
• glycine betaine degradation II (mammalian) (1/4 steps found)
• glycine betaine degradation III (3/7 steps found)
• formaldehyde assimilation I (serine pathway) (6/13 steps found)
• purine nucleobases degradation II (anaerobic) (12/24 steps found)

KEGG Metabolic Maps

• Cyanoamino acid metabolism
• Glycine, serine and threonine metabolism
• Methane metabolism
• One carbon pool by folate

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.1

Use Curated BLAST to search for 2.1.2.1

Sequence Analysis Tools

See Q2RVA2 at UniProt or InterPro

Protein Sequence (434 amino acids)

>Rru_A1142 Glycine hydroxymethyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MEASVAPPALRNAPCAGVNAACLSAADDAVAIAIAQETTRQRESIELIASENFVSKAVLE
AQGSVLTNKYAEGYPQRRYYGGCANVDRVEDLAIARLNQLFGSTYANVQPHSGSQANQAV
FLALLAPGDTILGLDLKAGGHLTHGAPVNISGRWFTAVSYGVDPRTHLIDMEQMADLARR
HRPKLLIAGGSAYPRLLDFARFRQIADEVGAILMVDMAHFAGLVAGGVYPSPVPFADVIT
STTHKTLRGPRGGFVLTNDAAIAKKINSAVFPGLQGGPLMHIIAAKAVAFGEALDPSFKI
YARRVVENCRVLAQTLLDGGLAITSGGTDCHLAVVDLRPLGVTGTIAEQALESIGITLNK
NAIPNDPEKPMVTSGIRVGSAAGTSRGFGPEEYRRIAALILETLHAVRAGTLEADREGIR
TRVRSLVAGFPLPY