Protein Info for Rru_A1140 in Rhodospirillum rubrum S1H

Annotation: Elongation factor G (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 671 PF00009: GTP_EFTU" amino acids 11 to 272 (262 residues), 85.9 bits, see alignment E=7e-28 PF14492: EFG_III" amino acids 379 to 449 (71 residues), 74 bits, see alignment E=2e-24 PF03764: EFG_IV" amino acids 451 to 568 (118 residues), 137.7 bits, see alignment E=4.2e-44 PF00679: EFG_C" amino acids 571 to 660 (90 residues), 73.5 bits, see alignment E=2.8e-24

Best Hits

Swiss-Prot: 52% identical to EFGL_SYNY3: Elongation factor G-like protein (sll0830) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02355, elongation factor G (inferred from 100% identity to rru:Rru_A1140)

Predicted SEED Role

"Translation elongation factor G-related protein" in subsystem Translation elongation factor G family

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVA4 at UniProt or InterPro

Protein Sequence (671 amino acids)

>Rru_A1140 Elongation factor G (NCBI) (Rhodospirillum rubrum S1H)
MPDRASAPRVAAIVGPYASGKTSLLESLLLATEAIHRKGTIQDHNTVGDSSPEARDREMG
VEVNLAETTYLGGQWTFLDCPGSVEFMQDTYNALTVCDVAVVVCEPDPARAVMLTPLLKF
LDSRAIPHMIFINKIETTETHLRDMIEALQMVSTKPLVAREIPIREDGKVVGYLDLVSER
AYRYKPGEASDLISIPEDLKDRHVNERQELLENLADYDDALLEGLLSDVVPPKGAVYDSL
ARDLAEDLVVPVFFGGALADNGIRRLLKALRHESPTLEETRARLGIEGKGPVIQVFKTQH
AEHMGKLSLARLWNGTLKDGQALNGDRATGLFSFPAGQQAKVDSVGAGAVVGIGKLEKLS
TGALVGGDSAADDPPVLGPLFALALHARKQGDDVKLTGALAKLCEEDPSLRVENNPDTAE
LLLWGQGDIHLQIAVRRLARQFHVEVEAHRPQVPYKETIRKATSRQGRFKRQTGGHGQFG
DVHLDIKPLSRGEGFVFTDSITGGVVPRQYIPAVEQGIREFLPRGPLGFPVVDVGVTLTD
GSYHVVDSSEQAFKSAAQLAMREGMPACEPVLLEPILRVEISVPTDATSRAQRALTTRRG
QILGYTPKEGWSGWDVVEGYLPQSEMHDLITDLRSATMGVGTFAWSFDHLQEVIGKQADE
VVTARKLVLAG