Protein Info for Rru_A1133 in Rhodospirillum rubrum S1H

Annotation: Excinuclease ABC, B subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 733 TIGR00631: excinuclease ABC subunit B" amino acids 37 to 689 (653 residues), 1007.4 bits, see alignment E=1.3e-307 PF04851: ResIII" amino acids 47 to 171 (125 residues), 45.7 bits, see alignment E=2.2e-15 PF00270: DEAD" amino acids 50 to 116 (67 residues), 30.8 bits, see alignment E=7.1e-11 PF17757: UvrB_inter" amino acids 192 to 281 (90 residues), 112.7 bits, see alignment E=2.2e-36 PF00271: Helicase_C" amino acids 472 to 578 (107 residues), 71.5 bits, see alignment E=2.1e-23 PF12344: UvrB" amino acids 585 to 626 (42 residues), 68.2 bits, see alignment 1.3e-22 PF02151: UVR" amino acids 660 to 691 (32 residues), 27.2 bits, see alignment (E = 7.4e-10)

Best Hits

Swiss-Prot: 68% identical to UVRB_ZYMMO: UvrABC system protein B (uvrB) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 100% identity to rru:Rru_A1133)

MetaCyc: 63% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVB1 at UniProt or InterPro

Protein Sequence (733 amino acids)

>Rru_A1133 Excinuclease ABC, B subunit (NCBI) (Rhodospirillum rubrum S1H)
MTDGAPPWSSPGGRLILRAMTMLLPLFERPPAGPRAEFRLASDYQPAGDQPQAIAELLRG
LAAQDRDQVLLGVTGSGKTFTMAQVIAEMGRPTLILAPNKTLAAQLYGEFKNFFPDNAVE
YFVSYYDYYQPEAYVPRTDTYIEKDSSINEQIDRMRHAATRALLERRDVIIVASVSCIYG
IGSVESYSRMIIPIKVGTTLPRADLLKALVELQFTRNDIAFTRGMFRVRGDSVEIFPAHY
EDRAWRVSLWGDEIESVREFDPLTGEITASLDEVTVYPASHHVTPRPALSQAVRTIKAEL
KETLARFYDQGKVLEAQRLEQRTTFDLEMIEATGHCKSIENYSRHLTGRRPGDPPPTLFE
YLPEDALLFVDESHVAVPQIGGMFRGDFNRKSVLAEFGFRLPSCVDNRPLKFEEWDVMRP
PSIFVSATPGRWELERTGGVVAEQVIRPTGLVDPVCIIRPVEAQVDDLLGEVKACAARGE
RVLVTTLTKRMSEDLTEYLTEQGVRVRYMHSDIETLERIEIIRDLRLGAFDVLVGINLLR
EGLDIPECALVAILDADKEGFLRSRTSLIQTIGRAARNVGGRVILYADKMTDSLTFAIEE
TSRRRQRQQDYNAAHGITPETVRSRISDVLSSVYEKDYVTVTTGVSGDNQLVGKSLREHL
ADLDKRMRAAAADLEFEEAGRLRDEIRRLEALDLGLPGDAGATGLAEAAIPLRAAVAKGR
GAAAKGRGRKGKR