Protein Info for Rru_A1119 in Rhodospirillum rubrum S1H

Annotation: NnrS (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 243 to 260 (18 residues), see Phobius details amino acids 272 to 296 (25 residues), see Phobius details amino acids 303 to 325 (23 residues), see Phobius details amino acids 337 to 358 (22 residues), see Phobius details amino acids 364 to 384 (21 residues), see Phobius details PF05940: NnrS" amino acids 12 to 392 (381 residues), 382.4 bits, see alignment E=1.5e-118

Best Hits

KEGG orthology group: K07234, uncharacterized protein involved in response to NO (inferred from 100% identity to rru:Rru_A1119)

Predicted SEED Role

"NnrS protein involved in response to NO" in subsystem Denitrification or Nitrosative stress or Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVC5 at UniProt or InterPro

Protein Sequence (396 amino acids)

>Rru_A1119 NnrS (NCBI) (Rhodospirillum rubrum S1H)
MSAPPILSRDVPFLSLGFRPFFLAAGLWAALAMGLWLPWLIGAAEAPTAFAPVDWHVHEM
LFGYAGAAVAGFLLTAVPNWTGQPPLVGAPLLALAGLWALGRLAILTSAGLGGETAAVLD
VALPILLALWTARALIRSGNRRNLVVVGLVLLLALASALHHAGALGLAETTRLGQRLGIA
TYVMMISLIGGRIIPTFTRNWLSGPGKTTYSGLLPPDFGAVDRAALILTALTLAAWLADL
GLAWAPLALAAGLAQALRLGRWRGWATRREPLLIILHLGYVWLPIGLILLAAAGIGLLPE
VAAAHALGVGAFGTMILAVMTRAILGHTGRPLRAGPATTALFALLLAAVTLRVLSAALPD
LGLWALHASASLWILAHLGFLILYGPMLLRKRIAGV