Protein Info for Rru_A1088 in Rhodospirillum rubrum S1H

Annotation: DNA recombination protein RuvA (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 PF01330: RuvA_N" amino acids 1 to 62 (62 residues), 74.3 bits, see alignment E=9.9e-25 TIGR00084: Holliday junction DNA helicase RuvA" amino acids 1 to 190 (190 residues), 117.1 bits, see alignment E=3.4e-38 PF14520: HHH_5" amino acids 72 to 130 (59 residues), 45 bits, see alignment E=1.9e-15 PF07499: RuvA_C" amino acids 162 to 207 (46 residues), 36.4 bits, see alignment 9.2e-13

Best Hits

Swiss-Prot: 100% identical to RUVA_RHORT: Holliday junction ATP-dependent DNA helicase RuvA (ruvA) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03550, holliday junction DNA helicase RuvA (inferred from 100% identity to rru:Rru_A1088)

Predicted SEED Role

"Holliday junction DNA helicase RuvA" in subsystem DNA-replication or RuvABC plus a hypothetical

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVF6 at UniProt or InterPro

Protein Sequence (212 amino acids)

>Rru_A1088 DNA recombination protein RuvA (NCBI) (Rhodospirillum rubrum S1H)
MIAKLKGLVDSVAEDHAVIDVGGVGYLVFCPARVLTRLPSPGQAVALVVETQVREDHISL
FGFLETAERDWFRLLSTVQGVGSKVALSVLSVLSAGQISQAIAAGDKAALGRAPGVGPKL
AARIASELKDKAVALGGMPAPPPRGAGTDAAGEGPPGGPTGDVLGDAVSALVNLGYGRSE
AVGAASRAAGLGATTVQGVIGLALRDLGRGGA