Protein Info for Rru_A1066 in Rhodospirillum rubrum S1H

Annotation: ABC transporter component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF00005: ABC_tran" amino acids 22 to 170 (149 residues), 52.5 bits, see alignment E=4.3e-18

Best Hits

Swiss-Prot: 44% identical to Y121_METJA: Uncharacterized ABC transporter ATP-binding protein MJ0121 (MJ0121) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A1066)

Predicted SEED Role

"Uncharacterized ABC transporter ATP-binding protein MJ0121"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVH8 at UniProt or InterPro

Protein Sequence (261 amino acids)

>Rru_A1066 ABC transporter component (NCBI) (Rhodospirillum rubrum S1H)
MIERITILGGQGRDGRADAVARLDLAMGDVVSIVGPTGSGKTTLINDIELFANADTPTGR
RVLINGERAPTAYRDDPARNPIALITQHTTFLSDLPVDVFLQTHARIRKAGGGRVDDLVA
ATLDFANQLTGEPVAPGLRMTELSGGQTRALLIADATLICDTPIVLLDEVENAGIHRSRA
LELLRQHRKIFLFVTHDPRIALLSDYRIVMRGGRIESVLVTDDHEKALAPQVARLDDMLS
RLRDSIRGGERVSVTDLGDAA